| request information: | |
| Catalog Code: | H00000427-M01 |
| Product Name: | ASAH1 Antibody |
| Product Description: | Mouse Monoclonal anti-ASAH1 (2C9) |
| Clone: | 2C9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 427 |
| Gene Symbol: | ASAH1 |
| Omim ID: | 228000, |
| Immunogen: | ASAH1 (NP_808592, 25 a.a. ~ 125 a.a) partial recombinant protein with GST tag. |
| Epitope: | PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPG LLGNFPGPFEEEMKGIAAVTD* |
| Specificity: | ASAH1 - N-acylsphingosine amidohydrolase (acid ceramidase) 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG3 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AC antibody, anti-ASAH antibody, anti-FLJ21558 antibody, anti-FLJ22079 antibody, anti-PHP antibody, anti-PHP32 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |