ExactAntigen

Mouse Polyclonal anti-ARSF | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00000416-A01
ProductName: ARSF Antibody
Product Description: Mouse Polyclonal anti-ARSF
Clonality: Polyclonal
Immunogen: ARSF (NP_004033, 101 a.a. ~ 211 a.a) partial recombinant protein with GST tag.
Epitope: NRRVIQNLAVPAGLPLNETTLAALLKKQGYSTGLIGKWHQGLNCDSRSDQCHHPYNYGFDYYYGMPFTLVDSCWPDPSRNTELAFESQLWLCVQLVAIAILTLTFGKLSG* ...
Specificity: ARSF - arylsulfatase F
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera
Background: This gene is a member of the sulfatase family, and more specifically, the arylsulfatase subfamily. Members of the subfamily share similarity in sequence and splice sites, and are clustered together on chromosome X, suggesting that they are derived from recent gene duplication events. Sulfatases are essential for the correct composition of bone and cartilage matrix. The activity of this protein, unlike that of arylsulfatase E, is not inhibited by warfarin.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: Whole antisera
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-ASF antibody
ProteinTarget: ARSF - arylsulfatase F
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 416
Gene_Symbol: ARSF
Omim_ID: 300003,
more information: company product webpage
Also see:
see all human ARSF antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about