| request information: | |
| Catalog Code: | H00000398-A01 |
| Product Name: | ARHGDIG Antibody |
| Product Description: | Mouse Polyclonal anti-ARHGDIG |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 398 |
| Gene Symbol: | ARHGDIG |
| Omim ID: | 602844 |
| Immunogen: | ARHGDIG (AAH47699, 1 a.a. ~ 226 a.a) full length recombinant protein with GST tag. |
| Epitope: | MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGP LPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGL RVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD* |
| Specificity: | ARHGDIG - Rho GDP dissociation inhibitor (GDI) gamma |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or more information: | company product webpage |