| request information: |
|
| Catalog Code: | H00000397-B01 |
| Product Name: | ARHGDIB Antibody |
| Product Description: | Mouse Polyclonal anti-ARHGDIB - Rho GDP dissociation inhibitor (GDI) beta, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 397 |
| Gene Symbol: | ARHGDIB |
| Immunogen: | ARHGDIB (NP_001166, 1 a.a. ~ 201 a.a) full-length human protein. |
| Epitope: | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESA
PGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTP
VEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-D4 antibody, anti-GDIA2 antibody, anti-GDID4 antibody, anti-LYGDI antibody, anti-Ly-GDI antibody, anti-RAP1GN1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |