| request information: |
|
| Catalog Code: | H00000397-A01 |
| Product Name: | ARHGDIB Antibody |
| Product Description: | Mouse Polyclonal anti-ARHGDIB |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 397 |
| Gene Symbol: | ARHGDIB |
| Omim ID: | 602843 |
| Immunogen: | ARHGDIB (AAH09200, 1 a.a. ~ 202 a.a) full length recombinant protein with GST tag. |
| Epitope: | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESA
PGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTP
VEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE* |
| Specificity: | ARHGDIB - Rho GDP dissociation inhibitor (GDI) beta |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-D4 antibody, anti-GDIA2 antibody, anti-GDID4 antibody, anti-LYGDI antibody, anti-Ly-GDI antibody, anti-RAP1GN1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
| Product References: | Zhao J, Lubman DM et al.. Comparative proteomic analysis of Barrett's metaplasia and esophageal adenocarcinomas using 2-D liquid mass mapping. Mol Cell Proteomics. 2006 Jul 8 |
order or
more information: | company product webpage |