| request information: |
|
| Catalog Code: | H00000396-B01 |
| Product Name: | ARHGDIA Antibody |
| Product Description: | Mouse Polyclonal anti-ARHGDIA |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 396 |
| Gene Symbol: | ARHGDIA |
| Omim ID: | 601925, |
| Immunogen: | ARHGDIA (AAH16031, 1 a.a. ~ 205 a.a) full-length human protein. |
| Epitope: | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVC
SSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEF
LTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD* |
| Specificity: | Mouse polyclonal antibody raised against a full-length human ARHGDIA protein. |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on transfected lysate. Abnova's recommended working dilutions for western analysis are as follows: 1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GDIA1 antibody, anti-MGC117248 antibody, anti-RHOGDI antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |