| request information: |
|
| Catalog Code: | H00000393-B01 |
| Product Name: | ARHGAP4 Antibody |
| Product Description: | Mouse Polyclonal anti-ARHGAP4 - Rho GTPase activating protein 4, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 393 |
| Gene Symbol: | ARHGAP4 |
| Immunogen: | ARHGAP4 (AAH52303, 1 a.a. ~ 986 a.a) full-length human protein. |
| Epitope: | MAAHGKLRRERGLQAEYETQVKEMRWQLSEQLRCLELQGELRRELLQELAEFMRRRAEVELEYSRGLEKLAERFSSRGG
RLGSSREHQSFRKEPSLLSPLHCWAVLLQHTRQQSRESAALSEVLAGPLAQRLSHIAEDVGRLVKKSRDLEQQLQDELL
EVVSELQTAKKTYQAYHMESVNAEAKLREAERQEEKRAGRSVPTTTAGATEAGPLRKSSLKKGGRLVEKLWPPQRPVAA
SSCAPVCWLQAGFLVHPP |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-C1 antibody, anti-KIAA0131 antibody, anti-RGC1 antibody, anti-RhoGAP4 antibody, anti-p115 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |