ExactAntigen

RHOC Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000389-M06
Product Type:Primary Antibody
Product Name:RHOC Antibody
List Price:295
Clonality:Monoclonal
Gene ID:389
Host:Mouse
Clone:1B7
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-RHOC - ras homolog gene family, member C (1B7)
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Alternate Names:anti-ARH9 antibody, anti-ARHC antibody, anti-RHOH9 antibody
Immunogen:RHOC (AAH07245, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Packaging:0.1 mg IgG purified Mouse ascites.
PackageSize:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, , Western Blot 1:500
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human RHOC antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about