| request information: |
|
| Catalog Code: | H00000389-A01 |
| Product Name: | RHOC Antibody |
| Product Description: | Mouse Polyclonal anti-RHOC |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 389 |
| Gene Symbol: | RHOC |
| Omim ID: | 165380 |
| Immunogen: | RHOC (NP_786886, 91 a.a. ~ 191 a.a) partial recombinant protein with GST tag. |
| Epitope: | SLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVRE
VFEMATRAGLQVRKNKRRRGC* |
| Specificity: | RHOC - ras homolog gene family, member C |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ARH9 antibody, anti-ARHC antibody, anti-RHOH9 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |