| request information: | |
| Catalog Code: | H00000387-M03 |
| Product Name: | RHOA Antibody |
| Product Description: | Mouse Monoclonal anti-RHOA (1A11) |
| Clone: | 1A11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 387 |
| Gene Symbol: | RHOA |
| Omim ID: | 165390 |
| Immunogen: | RHOA (AAH01360, 1 a.a. ~ 194 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDV ILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYME CSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL* |
| Specificity: | RHOA - ras homolog gene family, member A |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 lambda |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-ARH12 antibody, anti-ARHA antibody, anti-RHO12 antibody, anti-RHOH12 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |