| CatalogCode: | H00000387-M02 |
| ProductName: | RHOA Antibody |
| Product Description: | Mouse Monoclonal anti-RHOA (1G7-1D11) |
| Clone: | 1G7-1D11 |
| Clonality: | Monoclonal |
| Immunogen: | RHOA (AAH01360, 1 a.a. ~ 194 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL* ... |
| Specificity: | RHOA - ras homolog gene family, member A |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 lambda |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ARH12 antibody, anti-ARHA antibody, anti-RHO12 antibody, anti-RHOH12 antibody |
| ProteinTarget: | RHOA - ras homolog gene family, member A |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 387 |
| Gene_Symbol: | RHOA |
| Omim_ID: | 165390 H00000387-M04 |
order or
more information: | company product webpage |
| request information: |
|