| CatalogCode: | H00000368-A01 |
| ProductName: | ABCC6 Antibody |
| Product Description: | Mouse Polyclonal anti-ABCC6 |
| Clonality: | Polyclonal |
| Immunogen: | ABCC6 (NP_001162, 831 a.a. ~ 931 a.a) partial recombinant protein with GST tag. |
| Epitope: | IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV* ... |
| Specificity: | ABCC6 - ATP-binding cassette, sub-family C (CFTR/MRP), member 6 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ABC34 antibody, anti-ARA antibody, anti-EST349056 antibody, anti-MLP1 antibody, anti-MOATE antibody, anti-MRP6 antibody, anti-PXE antibody |
| ProteinTarget: | ABCC6 - ATP-binding cassette, sub-family C (CFTR/MRP), member 6 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 368 |
| Gene_Symbol: | ABCC6 |
| Omim_ID: | 177850, 264800, 603234 |