| Catalog Code: | H00000367-A01 |
| Product Type: | Primary Antibody |
| Product Name: | AR Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 367 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-AR |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The androgen receptor gene is more than 90 kb long and codes for a protein that has 3 major functional domains: the N-terminal domain, DNA-binding domain, and androgen-binding domain. The protein functions as a steroid-hormone activated transcription fact |
| Alternate Names: | anti-AIS antibody, anti-DHTR antibody, anti-HUMARA antibody, anti-KD antibody, anti-NR3C4 antibody, anti-SBMA antibody, anti-SMAX1 antibody, anti-TFM antibody |
| Immunogen: | AR (NP_000035, 221 a.a. ~ 321 a.a) partial recombinant protein with GST tag. |
| Epitope: | SKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGL* ... |
| Specificity: | AR - androgen receptor (dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease) |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. No preservative. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | AR |
| Omim ID: | 176807 300068 313200 313700 |