| request information: | |
| Catalog Code: | H00000355-M05 |
| Product Name: | FAS Antibody |
| Product Description: | Mouse Monoclonal anti-FAS (2G3) |
| Clone: | 2G3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 355 |
| Gene Symbol: | FAS |
| Omim ID: | 134637, 601859, |
| Immunogen: | FAS (NP_000034, 20 a.a. ~ 120 a.a) partial recombinant protein with GST tag. |
| Epitope: | SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFS SKCRRCRLCDEGHGLEVEINC* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ALPS1A antibody, anti-APO-1 antibody, anti-APT1 antibody, anti-Apo-1 Fas antibody, anti-CD95 antibody, anti-FAS1 antibody, anti-FASTM antibody, anti-TNFRSF6 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |
|