| CatalogCode: | H00000355-B01 |
| ProductType: | Primary Antibody |
| ProductName: | FAS Antibody |
| ListPrice: | 295 |
| Clonality: | Polyclonal |
| Gene_Id: | 355 |
| Host: | Mouse |
| ProductDescription: | Mouse Polyclonal anti-FAS - Fas (TNF receptor superfamily, member 6), MaxPab Antibody |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogen |
| ALTnames: | anti-ALPS1A antibody, anti-APO-1 antibody, anti-APT1 antibody, anti-Apo-1 Fas antibody, anti-CD95 antibody, anti-FAS1 antibody, anti-FASTM antibody, anti-TNFRSF6 antibody |
| Immunogen: | FAS (NP_000034, 1 a.a. ~ 335 a.a) full-length human protein. |
| Epitope: | MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVN ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| AppSummary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C.á Avoid freeze-thaw cycles. |