| request information: | |
| Catalog Code: | H00000334-M04 |
| Product Name: | amyloid beta (A4) precursor-like protein 2 Antibody |
| Product Description: | Mouse Monoclonal anti-amyloid beta (A4) precursor-like protein 2 (4B5) |
| Clone: | 4B5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 334 |
| Gene Symbol: | APLP2 |
| Omim ID: | 104776, |
| Immunogen: | APLP2 (AAH00373, 41 a.a. ~ 150 a.a) partial recombinant protein with GST tag. |
| Epitope: | AGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRD KKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQ |
| Specificity: | amyloid beta (A4) precursor-like protein 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-APPH antibody, anti-APPL2 antibody, anti-CDEBP antibody, anti-amyloid antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |