| CatalogCode: | H00000328-M02 |
| ProductName: | APEX1 Antibody |
| Product Description: | Mouse Monoclonal anti-APEX1 (4D1) |
| Clone: | 4D1 |
| Clonality: | Monoclonal |
| Immunogen: | APEX1 (NP_001632, 219 a.a. ~ 319 a.a) partial recombinant protein with GST tag. |
| Epitope: | DLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL* ... |
| Specificity: | APEX1 - APEX nuclease (multifunctional DNA repair enzyme) 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-APE antibody, anti-APE1 antibody, anti-APEN antibody, anti-APEX antibody, anti-APX antibody, anti-HAP1 antibody, anti-REF-1 antibody, anti-REF1 antibody |
| ProteinTarget: | APEX1 - APEX nuclease (multifunctional DNA repair enzyme) 1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 328 |
| Gene_Symbol: | APEX1 |
| Omim_ID: | 107748 H00000328-B01 |
order or
more information: | company product webpage |
| request information: |
|