| CatalogCode: | H00000328-A02 |
| ProductName: | APEX1 Antibody |
| Product Description: | Mouse Polyclonal anti-APEX1 |
| Clonality: | Polyclonal |
| Immunogen: | APEX1 (NP_001632, 219 a.a. ~ 319 a.a) partial recombinant protein with GST tag. |
| Epitope: | DLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL* ... |
| Specificity: | APEX1 - APEX nuclease (multifunctional DNA repair enzyme) 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-APE antibody, anti-APE1 antibody, anti-APEN antibody, anti-APEX antibody, anti-APX antibody, anti-HAP1 antibody, anti-REF-1 antibody, anti-REF1 antibody |
| ProteinTarget: | APEX1 - APEX nuclease (multifunctional DNA repair enzyme) 1 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 328 |
| Gene_Symbol: | APEX1 |
| Omim_ID: | 107748, |