| request information: |
|
| Catalog Code: | H00000322-A01 |
| Product Name: | amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) Antibody |
| Product Description: | Mouse Polyclonal anti-amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 322 |
| Gene Symbol: | APBB1 |
| Omim ID: | 602709, |
| Immunogen: | APBB1 (NP_001155, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGPEPGPANAKWLKEGQNQLRR
AATAHRDQNRNVTLTLAEEAS* |
| Specificity: | amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimer's disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene product's nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimer's disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants have been described for this gene but some of their full length sequence is not known. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FE65 antibody, anti-MGC:9072 antibody, anti-RIR antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |