ExactAntigen

AMY2B Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000280-A01
Product Type:Primary Antibody
Product Name:AMY2B Antibody
List Price:205
Clonality:Polyclonal
Gene ID:280
Host:Mouse
Product Description:Mouse Polyclonal anti-AMY2B
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are
Alternate Names:anti-AMY2 antibody
Immunogen:AMY2B (NP_066188, 19 a.a. ~ 118 a.a) partial recombinant protein with GST tag.
Epitope:PNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHM* ...
Specificity:AMY2B - amylase, alpha 2B; pancreatic
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:AMY2B
Omim ID:104660
see all human AMY2B antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about