| request information: |
|
| Catalog Code: | H00000251-M07 |
| Product Name: | ALPPL2 Antibody |
| Product Description: | Mouse Monoclonal anti-ALPPL2 (2B3) |
| Clone: | 2B3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 251 |
| Gene Symbol: | ALPPL2 |
| Omim ID: | 171810, |
| Immunogen: | ALPPL2 (NP_112603, 365 a.a. ~ 455 a.a) partial recombinant protein with GST tag. |
| Epitope: | SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSA
VPLDGETHAGE* |
| Specificity: | ALPPL2 - alkaline phosphatase, placental-like 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation and ELISA. |
| Background: | There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot, RNAi Validation |
| Species Summary: | Hu , |
| Alternate Names: | anti-ALPG antibody, anti-ALPPL antibody, anti-GCAP antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |