| CatalogCode: | H00000248-M03 |
| ProductName: | ALPI Antibody |
| Product Description: | Mouse Monoclonal anti-ALPI (3A8) |
| Clone: | 3A8 |
| Clonality: | Monoclonal |
| Immunogen: | ALPI (NP_001622, 74 a.a. ~ 163 a.a) partial recombinant protein with GST tag. |
| Epitope: | LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV* ... |
| Specificity: | ALPI - alkaline phosphatase, intestinal |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is upregulated during small intestinal epithelial cell differentiation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-IAP antibody |
| ProteinTarget: | ALPI - alkaline phosphatase, intestinal |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 248 |
| Gene_Symbol: | ALPI |
| Omim_ID: | 171740, |
order or
more information: | company product webpage |
| request information: |
|