| request information: |
|
| Catalog Code: | H00000242-A01 |
| Product Name: | ALOX12B Antibody |
| Product Description: | Mouse Polyclonal anti-ALOX12B |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 242 |
| Gene Symbol: | ALOX12B |
| Omim ID: | 242100 603741 |
| Immunogen: | ALOX12B (NP_001130, 171 a.a. ~ 262 a.a) partial recombinant protein with GST tag. |
| Epitope: | NPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIRKIFPGKKSV
VSEYVAEHWAED* |
| Specificity: | ALOX12B - arachidonate 12-lipoxygenase, 12R type |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes an enzyme involved in the converstion of arachidonic acid to 12R-hydroxyeicosatetraenoic acid. Mutations in this gene are associated with nonbullous congenital ichthyosiform erythroderma. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-12R-LOX antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |