ExactAntigen

anaplastic lymphoma kinase Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000238-A01
Product Type:Primary Antibody
Product Name:anaplastic lymphoma kinase Antibody
List Price:205
Clonality:Polyclonal
Gene ID:238
Host:Mouse
Product Description:Mouse Polyclonal anti-anaplastic lymphoma kinase
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The 2;5 chromosomal translocation is frequently associated with anaplastic large cell lymphomas (ALCLs). The translocation creates a fusion gene consisting of the ALK (anaplastic lymphoma kinase) gene and the nucleophosmin (NPM) gene: the 3' half of ALK,
Immunogen:ALK (NP_004295, 251 a.a. ~ 351 a.a) partial recombinant protein with GST tag.
Epitope:DSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVS* ...
Specificity:anaplastic lymphoma kinase (Ki-1)
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther appl
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug). $ 285 (10 ug). and $ 425 (25 ug).
Gene Symbol:ALK
Omim ID:105590,
see all human ALK antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about