| request information: |
|
| Catalog Code: | H00000223-A01 |
| Product Name: | ALDH9A1 Antibody |
| Product Description: | Mouse Polyclonal anti-ALDH9A1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 223 |
| Gene Symbol: | ALDH9A1 |
| Omim ID: | 602733 |
| Immunogen: | ALDH9A1 (NP_000687, 173 a.a. ~ 271 a.a) partial recombinant protein with GST tag. |
| Epitope: | CGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPV
TLELGGKSPLIIFSDCDMN* |
| Specificity: | ALDH9A1 - aldehyde dehydrogenase 9 family, member A1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This protein belongs to the aldehyde dehydrogenase family of proteins. It has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. The enzyme catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid (GABA). This isozyme is a tetramer of identical 54-kD subunits. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ALDH4 antibody, anti-ALDH7 antibody, anti-ALDH9 antibody, anti-E3 antibody, anti-TMABADH antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |