| request information: |
|
| Catalog Code: | H00000216-M01 |
| Product Name: | ALDH1A1 Antibody |
| Product Description: | Mouse Monoclonal anti-ALDH1A1 (1A2) |
| Clone: | 1A2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 216 |
| Gene Symbol: | ALDH1A1 |
| Omim ID: | 100640, |
| Immunogen: | ALDH1A1 (AAH01505, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRT
MDASERGRLLYKLADLIERDRLLLATMESMN |
| Specificity: | ALDH1A1 - aldehyde dehydrogenase 1 family, member A1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-ALDH1A1 antibody, anti-aldehyde dehydrogenase 1 family antibody, anti-member A1antibody, anti-ALDC antibody, anti-ALDH-E1 antibody, anti-ALDH1 antibody, anti-ALDH11 antibody, anti-MGC2318 antibody, anti-PUMB1 antibody, anti-RALDH1 antibody, anti-ALDH class 1 antibody, anti-acetaldehyde dehydrogenase 1 antibody, anti-aldehyde dehydrogenase 1 antibody, anti-soluble antibody, anti-aldehyde dehydrogenase 1A1 antibody, anti-aldehyde dehydrogenase antibody, anti-liver cytosolic antibody, anti-retinal dehydrogenase 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|