ExactAntigen

Mouse Monoclonal anti-AKT2 (1F8) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00000208-M04
ProductName: AKT2 Antibody
Product Description: Mouse Monoclonal anti-AKT2 (1F8)
Clone: 1F8
Clonality: Monoclonal
Immunogen: AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag.
Epitope: MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background: This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG Mix Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-PKBBETA antibody, anti-PRKBB antibody, anti-RAC-BETA antibody
ProteinTarget: AKT2
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 208
Gene_Symbol: AKT2
Omim_ID: 125853, 164731,
more information: company product webpage
Also see:
see all human AKT2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about