| Catalog Code: | H00000208-M02 |
| Product Type: | Primary Antibody |
| Product Name: | AKT2 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 208 |
| Host: | Mouse |
| Clone: | 1B4 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-AKT2 (1B4) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 o |
| Alternate Names: | anti-PKBBETA antibody, anti-PRKBB antibody, anti-RAC-BETA antibody |
| Immunogen: | AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. |
| Epitope: | MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | AKT2 |
| Omim ID: | 125853, 164731, |