ExactAntigen

AKT2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000208-M02
Product Type:Primary Antibody
Product Name:AKT2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:208
Host:Mouse
Clone:1B4
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-AKT2 (1B4)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 o
Alternate Names:anti-PKBBETA antibody, anti-PRKBB antibody, anti-RAC-BETA antibody
Immunogen:AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag.
Epitope:MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:AKT2
Omim ID:125853, 164731,
see all human AKT2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about