ExactAntigen

AKT2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000208-M01
Product Type:Primary Antibody
Product Name:AKT2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:208
Host:Mouse
Clone:1B3
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-AKT2 (1B3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = AKT2 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene is a putat
Alternate Names:anti-RAC-beta serine/threonine protein kinase antibody, anti-RAC-PK beta antibody, anti-PKB beta antibody, anti-Protein kinase beta antibody
Immunogen:AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag.
Epitope:MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII ...
Specificity:AKT2 - v-akt murine thymoma viral oncogene homolog 2
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:AKT2
Omim ID:164731 167000
see all human AKT2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about