| CatalogCode: | H00000208-A01 |
| ProductName: | AKT2 Antibody |
| Product Description: | Mouse Polyclonal anti-AKT2 |
| Clonality: | Polyclonal |
| Immunogen: | AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. |
| Epitope: | MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII ... |
| Specificity: | AKT2 - v-akt murine thymoma viral oncogene homolog 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-RAC-beta serine/threonine protein kinase antibody, anti-RAC-PK beta antibody, anti-PKB beta antibody, anti-Protein kinase beta antibody |
| ProteinTarget: | AKT2 - v-akt murine thymoma viral oncogene homolog 2 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 208 |
| Gene_Symbol: | AKT2 |
| Omim_ID: | 125853 164731 |