ExactAntigen

Mouse Monoclonal anti-AKT1 (4C3)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00000207-M01
ProductName:AKT1 Antibody
Product Description:Mouse Monoclonal anti-AKT1 (4C3)
Clone:4C3
Clonality:Monoclonal
Immunogen:AKT1 (AAH00479, 381 a.a. ~ 481 a.a) partial recombinant protein with GST tag.
Epitope:SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA* ...
Specificity:AKT1 - v-akt murine thymoma viral oncogene homolog 1
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against recombinant protein on ELISA.
Background:The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Multiple alternatively spliced transcript variants have been found for this gene.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA
SpeciesSummary:Hu
ALTnames:anti-MGC99656 antibody, anti-PKB antibody, anti-PRKBA antibody, anti-RAC antibody, anti-RAC-ALPHA antibody
ProteinTarget:AKT1 - v-akt murine thymoma viral oncogene homolog 1
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:207
Gene_Symbol:AKT1
Omim_ID:164730, 181500,
see all human AKT1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about