| request information: |
|
| Catalog Code: | H00000205-A02 |
| Product Name: | AK3L1 Antibody |
| Product Description: | Mouse Polyclonal anti-AK3L1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 205 |
| Gene Symbol: | AK3L1 |
| Omim ID: | 103030, |
| Immunogen: | AK3L1 (NP_982289, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELEN
RRGQHWLLDGFPRTLGQAEALDKICEVDLVI* |
| Specificity: | AK3L1 - adenylate kinase 3-like 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AK3 antibody, anti-AK4 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |