| request information: |
|
| Catalog Code: | H00000196-M04 |
| Product Name: | AHR Antibody |
| Product Description: | Mouse Monoclonal anti-AHR (4G7) |
| Clone: | 4G7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 196 |
| Gene Symbol: | AHR |
| Omim ID: | 600253, |
| Immunogen: | AHR (NP_001612, 721 a.a. ~ 821 a.a) partial recombinant protein with GST tag. |
| Epitope: | MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFL
NKFQNGVLNETYPAELNNINN* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG Mix Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |