| request information: |
|
| Catalog Code: | H00000191-M10 |
| Product Name: | AHCY Antibody |
| Product Description: | Mouse Monoclonal anti-AHCY (2F11-1D10) |
| Clone: | 2F11-1D10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 191 |
| Gene Symbol: | AHCY |
| Omim ID: | 180960 |
| Immunogen: | AHCY (AAH11606, 1 a.a. ~ 433 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSAS KPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCNIFST QDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLN MILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMM ANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVM IAGKVAVVAGYGDVGKGCAQALRGFGARVIITEID |
| Specificity: | AHCY - S-adenosylhomocysteine hydrolase |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Cytoplasmic |
| Background: | S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia. S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Ascites |
| Isotype: | IgM Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Adenosyl Homocysteine antibody, anti-2 S adenosyl L homocysteine antibody, anti-Adenosyl homo cys antibody, anti-adenosylhomo cys antibody, anti-Adenosylhomocysteine antibody, anti-AdoHcy antibody, anti-S adenosyl homocysteine antibody, anti-S adenosylhomocysteine antibody, anti-SAH antibody, anti-SAHH antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |