| Catalog Code: | H00000190-M03 |
| Product Type: | Primary Antibody |
| Product Name: | NR0B1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 190 |
| Host: | Mouse |
| Clone: | 1F10 |
| Isotype: | IgG3 Kappa |
| Product Description: | Mouse Monoclonal anti-NR0B1 (1F10) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 7-10. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encodes a protein that contains a DNA-binding domai |
| Alternate Names: | anti-AHC antibody, anti-AHCH antibody, anti-AHX antibody, anti-DAX-1 antibody, anti-DAX1 antibody, anti-DSS antibody, anti-GTD antibody, anti-HHG antibody, anti-NROB1 antibody |
| Immunogen: | NR0B1 (NP_000466, 361 a.a. ~ 471 a.a) partial recombinant protein with GST tag. |
| Epitope: | IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 100 ug purified IgG |
| Package Size: | 100 ug |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | NR0B1 |
| Omim ID: | 300018, 300200, 300473, |
|