ExactAntigen

Mouse Monoclonal anti-NR0B1 (2F12)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00000190-M02
ProductName:NR0B1 Antibody
Product Description:Mouse Monoclonal anti-NR0B1 (2F12)
Clone:2F12
Clonality:Monoclonal
Immunogen:NR0B1 (NP_000466, 361 a.a. ~ 471 a.a) partial recombinant protein with GST tag.
Epitope:IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI* ...
Specificity:NR0B1 - nuclear receptor subfamily 0, group B, member 1
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against recombinant protein on ELISA.
Background:This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA
SpeciesSummary:Hu
ALTnames:anti-AHC antibody, anti-AHCH antibody, anti-AHX antibody, anti-DAX-1 antibody, anti-DAX1 antibody, anti-DSS antibody, anti-GTD antibody, anti-HHG antibody, anti-NROB1 antibody
ProteinTarget:NR0B1 - nuclear receptor subfamily 0, group B, member 1
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:190
Gene_Symbol:NR0B1
Omim_ID:300018, 300200, 300473,
see all human DAX 1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about