ExactAntigen

NR0B1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000190-A01
Product Type:Primary Antibody
Product Name:NR0B1 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:190
Host:Mouse
Product Description:Mouse Polyclonal anti-NR0B1
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antago
Alternate Names:anti-AHC antibody, anti-AHCH antibody, anti-AHX antibody, anti-DAX-1 antibody, anti-DAX1 antibody, anti-DSS antibody, anti-GTD antibody, anti-HHG antibody, anti-NROB1 antibody
Immunogen:NR0B1 (NP_000466, 361 a.a. ~ 471 a.a) partial recombinant protein with GST tag.
Epitope:IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI* ...
Specificity:NR0B1 - nuclear receptor subfamily 0, group B, member 1
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:NR0B1
Omim ID:300018 300200 300473
see all human DAX 1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about