| Catalog Code: | H00000190-A01 |
| Product Type: | Primary Antibody |
| Product Name: | NR0B1 Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 190 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-NR0B1 |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antago |
| Alternate Names: | anti-AHC antibody, anti-AHCH antibody, anti-AHX antibody, anti-DAX-1 antibody, anti-DAX1 antibody, anti-DSS antibody, anti-GTD antibody, anti-HHG antibody, anti-NROB1 antibody |
| Immunogen: | NR0B1 (NP_000466, 361 a.a. ~ 471 a.a) partial recombinant protein with GST tag. |
| Epitope: | IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI* ... |
| Specificity: | NR0B1 - nuclear receptor subfamily 0, group B, member 1 |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. No preservative. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | NR0B1 |
| Omim ID: | 300018 300200 300473 |