| request information: |
|
| Catalog Code: | H00000182-M01A |
| Product Name: | JAG1 Antibody |
| Product Description: | Mouse Monoclonal anti-JAG1 (1E12) |
| Clone: | 1E12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 182 |
| Gene Symbol: | JAG1 |
| Omim ID: | 118450, 187500, 601920 |
| Immunogen: | JAG1 (NP_000205, 531 a.a. ~ 621 a.a) partial recombinant protein with GST tag. |
| Epitope: | PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQS
GGKFTCDCNKG* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AGS antibody, anti-AHD antibody, anti-AWS antibody, anti-HJ1 antibody, anti-JAGL1 antibody, anti-MGC104644 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |