| CatalogCode: | H00000182-A01 |
| ProductName: | JAG1 Antibody |
| Product Description: | Mouse Polyclonal anti-JAG1 |
| Clonality: | Polyclonal |
| Immunogen: | JAG1 (NP_000205, 531 a.a. ~ 621 a.a) partial recombinant protein with GST tag. |
| Epitope: | PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG* ... |
| Specificity: | JAG1 - jagged 1 (Alagille syndrome) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-AGS antibody, anti-AHD antibody, anti-AWS antibody, anti-HJ1 antibody, anti-JAGL1 antibody, anti-MGC104644 antibody |
| ProteinTarget: | JAG1 - jagged 1 (Alagille syndrome) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 182 |
| Gene_Symbol: | JAG1 |
| Omim_ID: | 118450 187500 601920 |