| CatalogCode: | H00000142-M01 |
| ProductName: | PARP1 Antibody |
| Product Description: | Mouse Monoclonal anti-PARP1 (3G4) |
| Clone: | 3G4 |
| Clonality: | Monoclonal |
| Immunogen: | PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD ... |
| Specificity: | PARP1 - poly (ADP-ribose) polymerase family, member 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ADPRT antibody, anti-ADPRT1 antibody, anti-PARP antibody, anti-PARP-1 antibody, anti-PPOL antibody, anti-pADPRT-1 antibody |
| ProteinTarget: | PARP1 - poly (ADP-ribose) polymerase family, member 1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 142 |
| Gene_Symbol: | PARP1 |
| Omim_ID: | 173870 NB100-61615 |
order or
more information: | company product webpage |
| request information: |
|