| request information: |
|
| Catalog Code: | H00000131-A01 |
| Product Name: | ADH7 Antibody |
| Product Description: | Mouse Polyclonal anti-ADH7 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 131 |
| Gene Symbol: | ADH7 |
| Omim ID: | 600086, |
| Immunogen: | ADH7 (NP_000664, 257 a.a. ~ 367 a.a) partial recombinant protein with GST tag. |
| Epitope: | MTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEF
LAKKFDLDQLITHVLPFKKISEGFELLNSGQ* |
| Specificity: | ADH7 - alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes class IV alcohol dehydrogenase 7 mu or sigma subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The enzyme encoded by this gene is inefficient in ethanol oxidation, but is the most active as a retinol dehydrogenase; thus it may participate in the synthesis of retinoic acid, a hormone important for cellular differentiation. The expression of this gene is much more abundant in stomach than liver, thus differing from the other known gene family members. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ADH-4 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |