ExactAntigen

ADD3 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000120-A01
Product Type:Primary Antibody
Product Name:ADD3 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:120
Host:Mouse
Product Description:Mouse Polyclonal anti-ADD3
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin
Alternate Names:anti-ADDL antibody
Immunogen:ADD3 (NP_058432, 462 a.a. ~ 561 a.a) partial recombinant protein with GST tag.
Epitope:PRTKITWMKAEDSSKVSGGTPIKIEDPNQFVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQFEDDDHGPPAPPNPFSHLTEG* ...
Specificity:ADD3 - adducin 3 (gamma)
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ADD3
Omim ID:601568
see all human ADD3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about