| request information: |
|
| Catalog Code: | H00000111-M01 |
| Product Name: | ADCY5 Antibody |
| Product Description: | Mouse Monoclonal anti-ADCY5 (3E6) |
| Clone: | 3E6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 111 |
| Gene Symbol: | ADCY5 |
| Omim ID: | 600293, |
| Immunogen: | ADCY5 (NP_899200, 1152 a.a. ~ 1262 a.a) partial recombinant protein with GST tag. |
| Epitope: | ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAA
NTYQLECRGVVKVKGKGEMMTYFLNGGPPLS* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | ADCY5 belongs to the adenylate cyclase (EC 4.6.1.1) family of enzymes responsible for the synthesis of cAMP (Ludwig and Seuwen, 2002 [PubMed 12503609]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |