| CatalogCode: | H00000087-A01 |
| ProductName: | ACTN1 Antibody |
| Product Description: | Mouse Polyclonal anti-ACTN1 |
| Clonality: | Polyclonal |
| Immunogen: | ACTN1 (NP_001093, 543 a.a. ~ 640 a.a) partial recombinant protein with GST tag. |
| Epitope: | EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA* ... |
| Specificity: | ACTN1 - actinin, alpha 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ProteinTarget: | ACTN1 - actinin, alpha 1 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 87 |
| Gene_Symbol: | ACTN1 |
| Omim_ID: | 102575 H00000087-M01 |