ExactAntigen

Mouse Monoclonal anti-ACTG1 - actin, gamma 1 (1G6) | Novus Biologicals antibody product information
CatalogCode:H00000071-M01
ProductName:ACTG1 Antibody
Product Description:Mouse Monoclonal anti-ACTG1 - actin, gamma 1 (1G6)
Clone:1G6
Clonality:Monoclonal
Immunogen:ACTG1 (AAH53572, 1 a.a. ~ 376 a.a) full length recombinant protein with GST tag.
Epitope:MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERF ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:Actins are highly conserved proteins that are involved in various types of cell motility, and maintenance of the cytoskeleton. In vertebrates, three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. Actin, gamma 1, encoded by this gene, is a cytoplasmic actin found in nonmuscle cells.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-ACT antibody, anti-ACTG antibody, anti-DFNA20 antibody, anti-DFNA26 antibody, anti-beta-actin antibody
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:71
Gene_Symbol:ACTG1
order or
more information
:
company product webpage
request information:
Also see:
all human ACTG1 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about