| request information: |
|
| Catalog Code: | H00000055-M01 |
| Product Name: | ACPP Antibody |
| Product Description: | Mouse Monoclonal anti-ACPP (2D11) |
| Clone: | 2D11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 55 |
| Gene Symbol: | ACPP |
| Omim ID: | 171790 |
| Immunogen: | ACPP (AAH07460, 310 a.a. ~ 418 a.a) partial recombinant protein with GST tag. |
| Epitope: | YASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELAGPVIPQDWSTECMTTNSHQVLKVIFAVA
FCLISAVLMVLLFIHIRRGLCWQRESYGNI |
| Specificity: | ACPP - acid phosphatase, prostate |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene encodes an enzyme which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and secreted by the epithelial cells of the prostrate gland. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-ACP-3 antibody, anti-ACP3 antibody, anti-PAP antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |