ExactAntigen

aconitase 2, mitochondrial Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000050-M01
Product Type:Primary Antibody
Product Name:aconitase 2, mitochondrial Antibody
List Price:275
Clonality:Monoclonal
Gene ID:50
Host:Mouse
Clone:1A11
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-aconitase 2, mitochondrial (1A11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Genbank acession number is BC014092. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The protein enc
Alternate Names:anti-ACONM antibody, anti-MGC20605 antibody, anti-MGC33908 antibody, anti-aconitase antibody
Immunogen:ACO2 (AAH14092, 1 a.a. ~ 179 a.a) partial recombinant protein with GST tag.
Epitope:MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILE ...
Specificity:aconitase 2, mitochondrial
Purity:IgG purified
Buffer:1X PBS pH 7.2
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug). $ 285 (10 ug). and $ 425 (25 ug).
Gene Symbol:ACO2
Omim ID:100850,
see all human ACO2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about