| request information: |
|
| Catalog Code: | H00000048-M01 |
| Product Name: | ACO1 Antibody |
| Product Description: | Mouse Monoclonal anti-ACO1 (2C1) |
| Clone: | 2C1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 48 |
| Gene Symbol: | ACO1 |
| Omim ID: | 100880, |
| Immunogen: | ACO1 (AAH18103, 780 a.a. ~ 890 a.a) partial recombinant protein with GST tag. |
| Epitope: | RDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPG ENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVM RFDTDVELTYFLNGGILNYMIRKMAK* |
| Specificity: | ACO1 - aconitase 1, soluble |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Cytoplasmic |
| Background: | Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Aconitase 1 antibody, anti-ACO 1 antibody, anti-ACO1 antibody, anti-Aconitase 1 soluble antibody, anti-Aconitase antibody, anti-Aconitase1 antibody, anti-Aconitate hydratase antibody, anti-Citrate hydro lyase antibody, anti-Ferritin repressor protein antibody, anti-IRE BP 1 antibody, anti-IREB 1 antibody, anti-IREB1 antibody, anti-IREBP antibody, anti-Iron regulatory protein 1 antibody, anti-Iron responsive element binding protein 1 antibody, anti-IRP 1 antibody, anti-IRP1 antibody, anti-OTTHUMP00000045233 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|