ExactAntigen

ACHE Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00000043-M02
Product Name:ACHE Antibody
Product Description:Mouse Monoclonal anti-ACHE (2C3)
Clone:2C3
Clonality:Monoclonal
ListPrice:295
Gene ID:43
Gene Symbol:ACHE
Omim ID:100740, 112100
Immunogen:ACHE (NP_000656, 515 a.a. ~ 615 a.a) partial recombinant protein with GST tag.
Epitope:ARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSS
YMVHWKNQFDHYSKQDRCSDL*
Specificity:ACHE - acetylcholinesterase (YT blood group)
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against cell lysate for western blot. It has also been used for ELISA.
Background:Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood group antigen. Acetylcholinesterase exists in multiple molecular forms which possess similar catalytic properties, but differ in their oligomeric assembly and mode of cell attachment to the cell surface. It is encoded by the single ACHE gene, and the structural diversity in the gene products arises from alternative mRNA splicing, and post-translational associations of catalytic and structural subunits. The major form of acetylcholinesterase found in brain, muscle and other tissues is the hydrophilic species, which forms disulfide-linked oligomers with collagenous, or lipid-containing structural subunits. The other, alternatively spliced form, expressed primarily in the erythroid tissues, differs at the C-terminal end, and contains a cleavable hydrophobic peptide with a GPI-anchor site. It associates with the membranes through the phosphoinositide (PI) moieties added post-translationally.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu ,
Alternate Names:anti-ACHE antibody, anti-YT antibody, anti-acetylcholinesterase (YT blood group) antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human acetylcholinesterase antibodies


2008©ExactAntigen home | browse | about