| request information: |
|
| Catalog Code: | H00000035-B01 |
| Product Name: | ACADS Antibody |
| Product Description: | Mouse Polyclonal anti-ACADS - acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 35 |
| Gene Symbol: | ACADS |
| Omim ID: | 201470 |
| Immunogen: | ACADS (1 a.a. ~ 412 a.a) full-length human protein. |
| Epitope: | MAAALLARASGPARRALCPRAWRQLHTIYQSVELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGL
LAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPG
NGSDAGAASTTARAEGDSWVLNGTKAWITNAWEASAAVVFASTDRALQNKSISAFLVPMPTPGLTLGKKEDKLGIRGSS
TANLIFEDCRIPKDSILG |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA. |
| Background: | This gene encodes a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ACAD3 antibody, anti-SCAD antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |